Anti SP5 pAb (ATL-HPA074123)

Catalog No:
ATL-HPA074123-25
$303.00

Description

Product Description

Protein Description: Sp5 transcription factor
Gene Name: SP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075304: 100%, ENSRNOG00000054086: 100%
Entrez Gene ID: 389058
Uniprot ID: Q6BEB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKM
Gene Sequence PDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKM
Gene ID - Mouse ENSMUSG00000075304
Gene ID - Rat ENSRNOG00000054086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SP5 pAb (ATL-HPA074123)
Datasheet Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link)
Vendor Page Anti SP5 pAb (ATL-HPA074123) at Atlas Antibodies

Documents & Links for Anti SP5 pAb (ATL-HPA074123)
Datasheet Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link)
Vendor Page Anti SP5 pAb (ATL-HPA074123)

Product Description

Protein Description: Sp5 transcription factor
Gene Name: SP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075304: 100%, ENSRNOG00000054086: 100%
Entrez Gene ID: 389058
Uniprot ID: Q6BEB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKM
Gene Sequence PDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKM
Gene ID - Mouse ENSMUSG00000075304
Gene ID - Rat ENSRNOG00000054086
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SP5 pAb (ATL-HPA074123)
Datasheet Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link)
Vendor Page Anti SP5 pAb (ATL-HPA074123) at Atlas Antibodies

Documents & Links for Anti SP5 pAb (ATL-HPA074123)
Datasheet Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link)
Vendor Page Anti SP5 pAb (ATL-HPA074123)