Protein Description: Sp5 transcription factor
Gene Name: SP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075304: 100%, ENSRNOG00000054086: 100%
Entrez Gene ID: 389058
Uniprot ID: Q6BEB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075304: 100%, ENSRNOG00000054086: 100%
Entrez Gene ID: 389058
Uniprot ID: Q6BEB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PDFLQVPYDPALGSPSRLFHPWTADMPAHSPGALPPPHPSLGLTPQKTHLQPSFGAAHELPLTPPADPSYPYEFSPVKM |
| Documents & Links for Anti SP5 pAb (ATL-HPA074123) | |
| Datasheet | Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link) |
| Vendor Page | Anti SP5 pAb (ATL-HPA074123) at Atlas |
| Documents & Links for Anti SP5 pAb (ATL-HPA074123) | |
| Datasheet | Anti SP5 pAb (ATL-HPA074123) Datasheet (External Link) |
| Vendor Page | Anti SP5 pAb (ATL-HPA074123) |