Protein Description: SP140 nuclear body protein
Gene Name: SP140
Alternative Gene Name: LYSP100-A, LYSP100-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033964: 30%, ENSRNOG00000021116: 33%
Entrez Gene ID: 11262
Uniprot ID: Q13342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SP140
Alternative Gene Name: LYSP100-A, LYSP100-B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033964: 30%, ENSRNOG00000021116: 33%
Entrez Gene ID: 11262
Uniprot ID: Q13342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LSLLPGEGEEGSDDCSEMCDGEERQEASSSLARRGSVSSELENHPMNEEGESEELASSLLYDNVPGAEQSA |
Documents & Links for Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) | |
Datasheet | Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) at Atlas |
Documents & Links for Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) | |
Datasheet | Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SP140 pAb (ATL-HPA067493 w/enhanced validation) |