Description
Product Description
Protein Description: SRY (sex determining region Y)-box 15
Gene Name: SOX15
Alternative Gene Name: SOX20, SOX26, SOX27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041287: 71%, ENSRNOG00000005927: 36%
Entrez Gene ID: 6665
Uniprot ID: O60248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SOX15
Alternative Gene Name: SOX20, SOX26, SOX27
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041287: 71%, ENSRNOG00000005927: 36%
Entrez Gene ID: 6665
Uniprot ID: O60248
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL |
Gene Sequence | SSHCKLEAPSPCSLPQSDPRLQGELLPTYTHYLPPGSPTPYNPPLAGAPMPLTHL |
Gene ID - Mouse | ENSMUSG00000041287 |
Gene ID - Rat | ENSRNOG00000005927 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SOX15 pAb (ATL-HPA074049) | |
Datasheet | Anti SOX15 pAb (ATL-HPA074049) Datasheet (External Link) |
Vendor Page | Anti SOX15 pAb (ATL-HPA074049) at Atlas Antibodies |
Documents & Links for Anti SOX15 pAb (ATL-HPA074049) | |
Datasheet | Anti SOX15 pAb (ATL-HPA074049) Datasheet (External Link) |
Vendor Page | Anti SOX15 pAb (ATL-HPA074049) |