Description
Product Description
Protein Description: sosondowah ankyrin repeat domain family member A
Gene Name: SOWAHA
Alternative Gene Name: ANKRD43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044352: 86%, ENSRNOG00000060061: 88%
Entrez Gene ID: 134548
Uniprot ID: Q2M3V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SOWAHA
Alternative Gene Name: ANKRD43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044352: 86%, ENSRNOG00000060061: 88%
Entrez Gene ID: 134548
Uniprot ID: Q2M3V2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQD |
Gene Sequence | LRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFLGVLADDLMLQD |
Gene ID - Mouse | ENSMUSG00000044352 |
Gene ID - Rat | ENSRNOG00000060061 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SOWAHA pAb (ATL-HPA064621) | |
Datasheet | Anti SOWAHA pAb (ATL-HPA064621) Datasheet (External Link) |
Vendor Page | Anti SOWAHA pAb (ATL-HPA064621) at Atlas Antibodies |
Documents & Links for Anti SOWAHA pAb (ATL-HPA064621) | |
Datasheet | Anti SOWAHA pAb (ATL-HPA064621) Datasheet (External Link) |
Vendor Page | Anti SOWAHA pAb (ATL-HPA064621) |