Anti SORCS2 pAb (ATL-HPA061916)

Atlas Antibodies

Catalog No: ATL-HPA061916-25

• 

Product Description

Protein Description: sortilin-related VPS10 domain containing receptor 2
Gene Name: SORCS2
Alternative Gene Name: KIAA1329
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029093: 89%, ENSRNOG00000007033: 86%
Entrez Gene ID: 57537
Uniprot ID: Q96PQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYG
• Gene Sequence: DWELVKVDFRPSFSRQCGEEDYSSWELSNLQGDRCIMGQQRSFRKRKSTSWCIKGRSFTSALTSRVCECRDSDFLCDYG
• Gene ID - Mouse: ENSMUSG00000029093
• Gene ID - Rat: ENSRNOG00000007033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.