Anti SORBS2 pAb (ATL-HPA036755)

Atlas Antibodies

Catalog No: ATL-HPA036755-25

• 
• 

Product Description

Protein Description: sorbin and SH3 domain containing 2
Gene Name: SORBS2
Alternative Gene Name: ARGBP2, KIAA0777
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031626: 78%, ENSRNOG00000013391: 77%
Entrez Gene ID: 8470
Uniprot ID: O94875
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
• Gene Sequence: PERNSSLRALRRSPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPRSYSSTLTDMGRSAPRER
• Gene ID - Mouse: ENSMUSG00000031626
• Gene ID - Rat: ENSRNOG00000013391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.