Anti SOHLH1 pAb (ATL-HPA059439)

Atlas Antibodies

Catalog No: ATL-HPA059439-25

• 

Product Description

Protein Description: spermatogenesis and oogenesis specific basic helix-loop-helix 1
Gene Name: SOHLH1
Alternative Gene Name: bA100C15.3, bHLHe80, C9orf157, NOHLH, SPATA27, TEB2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029546: 30%, ENSRNOG00000016254: 32%
Entrez Gene ID: 402381
Uniprot ID: Q5JUK2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP
• Gene Sequence: PWSLDPASASPEPVPHILASSRQWDPASCTSLGTDKCEALLGLCQVRGGLPPFSEPSSLVPWPPGRSLPKAVRP
• Gene ID - Mouse: ENSMUSG00000029546
• Gene ID - Rat: ENSRNOG00000016254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.