Description
Product Description
Protein Description: suppressor of cytokine signaling 4
Gene Name: SOCS4
Alternative Gene Name: SOCS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048379: 80%, ENSRNOG00000011377: 78%
Entrez Gene ID: 122809
Uniprot ID: Q8WXH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SOCS4
Alternative Gene Name: SOCS7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048379: 80%, ENSRNOG00000011377: 78%
Entrez Gene ID: 122809
Uniprot ID: Q8WXH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS |
Gene Sequence | GYVWSGKKLSWSKKSESYSDAETVNGIEKTEVSLRNQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSS |
Gene ID - Mouse | ENSMUSG00000048379 |
Gene ID - Rat | ENSRNOG00000011377 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SOCS4 pAb (ATL-HPA057961) | |
Datasheet | Anti SOCS4 pAb (ATL-HPA057961) Datasheet (External Link) |
Vendor Page | Anti SOCS4 pAb (ATL-HPA057961) at Atlas Antibodies |
Documents & Links for Anti SOCS4 pAb (ATL-HPA057961) | |
Datasheet | Anti SOCS4 pAb (ATL-HPA057961) Datasheet (External Link) |
Vendor Page | Anti SOCS4 pAb (ATL-HPA057961) |