Anti SOCS3 pAb (ATL-HPA068569)

Catalog No:
ATL-HPA068569-25
$328.00

Description

Product Description

Protein Description: suppressor of cytokine signaling 3
Gene Name: SOCS3
Alternative Gene Name: CIS3, Cish3, SOCS-3, SSI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053113: 93%, ENSRNOG00000002946: 91%
Entrez Gene ID: 9021
Uniprot ID: O14543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Gene Sequence FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Gene ID - Mouse ENSMUSG00000053113
Gene ID - Rat ENSRNOG00000002946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SOCS3 pAb (ATL-HPA068569)
Datasheet Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link)
Vendor Page Anti SOCS3 pAb (ATL-HPA068569) at Atlas Antibodies

Documents & Links for Anti SOCS3 pAb (ATL-HPA068569)
Datasheet Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link)
Vendor Page Anti SOCS3 pAb (ATL-HPA068569)

Product Description

Protein Description: suppressor of cytokine signaling 3
Gene Name: SOCS3
Alternative Gene Name: CIS3, Cish3, SOCS-3, SSI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053113: 93%, ENSRNOG00000002946: 91%
Entrez Gene ID: 9021
Uniprot ID: O14543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Gene Sequence FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Gene ID - Mouse ENSMUSG00000053113
Gene ID - Rat ENSRNOG00000002946
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SOCS3 pAb (ATL-HPA068569)
Datasheet Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link)
Vendor Page Anti SOCS3 pAb (ATL-HPA068569) at Atlas Antibodies

Documents & Links for Anti SOCS3 pAb (ATL-HPA068569)
Datasheet Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link)
Vendor Page Anti SOCS3 pAb (ATL-HPA068569)