Anti SOCS3 pAb (ATL-HPA068569)

Atlas Antibodies

Catalog No: ATL-HPA068569-25

• 

Product Description

Protein Description: suppressor of cytokine signaling 3
Gene Name: SOCS3
Alternative Gene Name: CIS3, Cish3, SOCS-3, SSI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053113: 93%, ENSRNOG00000002946: 91%
Entrez Gene ID: 9021
Uniprot ID: O14543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Gene Sequence: FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
• Gene ID - Mouse: ENSMUSG00000053113
• Gene ID - Rat: ENSRNOG00000002946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.