Protein Description: suppressor of cytokine signaling 3
Gene Name: SOCS3
Alternative Gene Name: CIS3, Cish3, SOCS-3, SSI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053113: 93%, ENSRNOG00000002946: 91%
Entrez Gene ID: 9021
Uniprot ID: O14543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SOCS3
Alternative Gene Name: CIS3, Cish3, SOCS-3, SSI-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053113: 93%, ENSRNOG00000002946: 91%
Entrez Gene ID: 9021
Uniprot ID: O14543
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | FPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL |
Documents & Links for Anti SOCS3 pAb (ATL-HPA068569) | |
Datasheet | Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link) |
Vendor Page | Anti SOCS3 pAb (ATL-HPA068569) at Atlas |
Documents & Links for Anti SOCS3 pAb (ATL-HPA068569) | |
Datasheet | Anti SOCS3 pAb (ATL-HPA068569) Datasheet (External Link) |
Vendor Page | Anti SOCS3 pAb (ATL-HPA068569) |