Anti SNX9 pAb (ATL-HPA057203)

Catalog No:
ATL-HPA057203-25
$447.00

Description

Product Description

Protein Description: sorting nexin 9
Gene Name: SNX9
Alternative Gene Name: SDP1, SH3PX1, SH3PXD3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002365: 89%, ENSRNOG00000046874: 91%
Entrez Gene ID: 51429
Uniprot ID: Q9Y5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
Gene Sequence RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
Gene ID - Mouse ENSMUSG00000002365
Gene ID - Rat ENSRNOG00000046874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SNX9 pAb (ATL-HPA057203)
Datasheet Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link)
Vendor Page Anti SNX9 pAb (ATL-HPA057203) at Atlas Antibodies

Documents & Links for Anti SNX9 pAb (ATL-HPA057203)
Datasheet Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link)
Vendor Page Anti SNX9 pAb (ATL-HPA057203)

Product Description

Protein Description: sorting nexin 9
Gene Name: SNX9
Alternative Gene Name: SDP1, SH3PX1, SH3PXD3A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002365: 89%, ENSRNOG00000046874: 91%
Entrez Gene ID: 51429
Uniprot ID: Q9Y5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
Gene Sequence RVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVA
Gene ID - Mouse ENSMUSG00000002365
Gene ID - Rat ENSRNOG00000046874
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SNX9 pAb (ATL-HPA057203)
Datasheet Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link)
Vendor Page Anti SNX9 pAb (ATL-HPA057203) at Atlas Antibodies

Documents & Links for Anti SNX9 pAb (ATL-HPA057203)
Datasheet Anti SNX9 pAb (ATL-HPA057203) Datasheet (External Link)
Vendor Page Anti SNX9 pAb (ATL-HPA057203)