Description
Product Description
Protein Description: sorting nexin 5
Gene Name: SNX5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027423: 90%, ENSRNOG00000006077: 90%
Entrez Gene ID: 27131
Uniprot ID: Q9Y5X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNX5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027423: 90%, ENSRNOG00000006077: 90%
Entrez Gene ID: 27131
Uniprot ID: Q9Y5X3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL |
Gene Sequence | MVVVPELLQQQEEDRSKLRSVSVDLNVDPSL |
Gene ID - Mouse | ENSMUSG00000027423 |
Gene ID - Rat | ENSRNOG00000006077 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SNX5 pAb (ATL-HPA076450) | |
Datasheet | Anti SNX5 pAb (ATL-HPA076450) Datasheet (External Link) |
Vendor Page | Anti SNX5 pAb (ATL-HPA076450) at Atlas Antibodies |
Documents & Links for Anti SNX5 pAb (ATL-HPA076450) | |
Datasheet | Anti SNX5 pAb (ATL-HPA076450) Datasheet (External Link) |
Vendor Page | Anti SNX5 pAb (ATL-HPA076450) |