Description
Product Description
Protein Description: sorting nexin 29
Gene Name: SNX29
Alternative Gene Name: FLJ12363, RUNDC2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071669: 86%, ENSRNOG00000002294: 86%
Entrez Gene ID: 92017
Uniprot ID: Q8TEQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNX29
Alternative Gene Name: FLJ12363, RUNDC2A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071669: 86%, ENSRNOG00000002294: 86%
Entrez Gene ID: 92017
Uniprot ID: Q8TEQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDGEVTVA |
Gene Sequence | LRNLLDGEMEHSAALRQEVDTLKRKVAEQEERQGMKVQALARENEVLKVQLKKYVGAVQMLKREGQTAEVPNLWSVDGEVTVA |
Gene ID - Mouse | ENSMUSG00000071669 |
Gene ID - Rat | ENSRNOG00000002294 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) | |
Datasheet | Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) | |
Datasheet | Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNX29 pAb (ATL-HPA062810 w/enhanced validation) |