Description
Product Description
Protein Description: sorting nexin 10
Gene Name: SNX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038301: 100%, ENSRNOG00000011944: 100%
Entrez Gene ID: 29887
Uniprot ID: Q9Y5X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNX10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038301: 100%, ENSRNOG00000011944: 100%
Entrez Gene ID: 29887
Uniprot ID: Q9Y5X0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCV |
| Gene ID - Mouse | ENSMUSG00000038301 |
| Gene ID - Rat | ENSMUSG00000038301 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SNX10 pAb (ATL-HPA064782) | |
| Datasheet | Anti SNX10 pAb (ATL-HPA064782) Datasheet (External Link) |
| Vendor Page | Anti SNX10 pAb (ATL-HPA064782) at Atlas Antibodies |
| Documents & Links for Anti SNX10 pAb (ATL-HPA064782) | |
| Datasheet | Anti SNX10 pAb (ATL-HPA064782) Datasheet (External Link) |
| Vendor Page | Anti SNX10 pAb (ATL-HPA064782) |