Anti SNTG2 pAb (ATL-HPA077904)

Catalog No:
ATL-HPA077904-25
$447.00
Protein Description: syntrophin gamma 2
Gene Name: SNTG2
Alternative Gene Name: G2SYN, SYN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020672: 77%, ENSRNOG00000004928: 76%
Entrez Gene ID: 54221
Uniprot ID: Q9NY99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK
Gene ID - Mouse ENSMUSG00000020672
Gene ID - Rat ENSMUSG00000020672
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SNTG2 pAb (ATL-HPA077904)
Datasheet Anti SNTG2 pAb (ATL-HPA077904) Datasheet (External Link)
Vendor Page Anti SNTG2 pAb (ATL-HPA077904) at Atlas

Documents & Links for Anti SNTG2 pAb (ATL-HPA077904)
Datasheet Anti SNTG2 pAb (ATL-HPA077904) Datasheet (External Link)
Vendor Page Anti SNTG2 pAb (ATL-HPA077904)