Protein Description: syntrophin gamma 2
Gene Name: SNTG2
Alternative Gene Name: G2SYN, SYN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020672: 77%, ENSRNOG00000004928: 76%
Entrez Gene ID: 54221
Uniprot ID: Q9NY99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNTG2
Alternative Gene Name: G2SYN, SYN5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020672: 77%, ENSRNOG00000004928: 76%
Entrez Gene ID: 54221
Uniprot ID: Q9NY99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQGADSSQTFRPKFLALK |
| Documents & Links for Anti SNTG2 pAb (ATL-HPA077904) | |
| Datasheet | Anti SNTG2 pAb (ATL-HPA077904) Datasheet (External Link) |
| Vendor Page | Anti SNTG2 pAb (ATL-HPA077904) at Atlas |
| Documents & Links for Anti SNTG2 pAb (ATL-HPA077904) | |
| Datasheet | Anti SNTG2 pAb (ATL-HPA077904) Datasheet (External Link) |
| Vendor Page | Anti SNTG2 pAb (ATL-HPA077904) |