Protein Description: syntrophin, gamma 1
Gene Name: SNTG1
Alternative Gene Name: G1SYN, SYN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025909: 92%, ENSRNOG00000007294: 93%
Entrez Gene ID: 54212
Uniprot ID: Q9NSN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNTG1
Alternative Gene Name: G1SYN, SYN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025909: 92%, ENSRNOG00000007294: 93%
Entrez Gene ID: 54212
Uniprot ID: Q9NSN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LLHSRFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNISNLTKHNIKKINRNFPVNQQIVY |
Documents & Links for Anti SNTG1 pAb (ATL-HPA072282) | |
Datasheet | Anti SNTG1 pAb (ATL-HPA072282) Datasheet (External Link) |
Vendor Page | Anti SNTG1 pAb (ATL-HPA072282) at Atlas |
Documents & Links for Anti SNTG1 pAb (ATL-HPA072282) | |
Datasheet | Anti SNTG1 pAb (ATL-HPA072282) Datasheet (External Link) |
Vendor Page | Anti SNTG1 pAb (ATL-HPA072282) |