Anti SNTA1 pAb (ATL-HPA067154)

Catalog No:
ATL-HPA067154-25
$447.00

Description

Product Description

Protein Description: syntrophin alpha 1
Gene Name: SNTA1
Alternative Gene Name: LQT12, SNT1, TACIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 98%, ENSRNOG00000016062: 98%
Entrez Gene ID: 6640
Uniprot ID: Q13424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Gene Sequence GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Gene ID - Mouse ENSMUSG00000027488
Gene ID - Rat ENSRNOG00000016062
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SNTA1 pAb (ATL-HPA067154)
Datasheet Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link)
Vendor Page Anti SNTA1 pAb (ATL-HPA067154) at Atlas Antibodies

Documents & Links for Anti SNTA1 pAb (ATL-HPA067154)
Datasheet Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link)
Vendor Page Anti SNTA1 pAb (ATL-HPA067154)

Product Description

Protein Description: syntrophin alpha 1
Gene Name: SNTA1
Alternative Gene Name: LQT12, SNT1, TACIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 98%, ENSRNOG00000016062: 98%
Entrez Gene ID: 6640
Uniprot ID: Q13424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Gene Sequence GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Gene ID - Mouse ENSMUSG00000027488
Gene ID - Rat ENSRNOG00000016062
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SNTA1 pAb (ATL-HPA067154)
Datasheet Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link)
Vendor Page Anti SNTA1 pAb (ATL-HPA067154) at Atlas Antibodies

Documents & Links for Anti SNTA1 pAb (ATL-HPA067154)
Datasheet Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link)
Vendor Page Anti SNTA1 pAb (ATL-HPA067154)