Protein Description: syntrophin alpha 1
Gene Name: SNTA1
Alternative Gene Name: LQT12, SNT1, TACIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 98%, ENSRNOG00000016062: 98%
Entrez Gene ID: 6640
Uniprot ID: Q13424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNTA1
Alternative Gene Name: LQT12, SNT1, TACIP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027488: 98%, ENSRNOG00000016062: 98%
Entrez Gene ID: 6640
Uniprot ID: Q13424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS |
Documents & Links for Anti SNTA1 pAb (ATL-HPA067154) | |
Datasheet | Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link) |
Vendor Page | Anti SNTA1 pAb (ATL-HPA067154) at Atlas |
Documents & Links for Anti SNTA1 pAb (ATL-HPA067154) | |
Datasheet | Anti SNTA1 pAb (ATL-HPA067154) Datasheet (External Link) |
Vendor Page | Anti SNTA1 pAb (ATL-HPA067154) |