Anti SNRPB2 pAb (ATL-HPA076104)

Atlas Antibodies

Catalog No: ATL-HPA076104-25

• 
• 

Product Description

Protein Description: small nuclear ribonucleoprotein polypeptide B2
Gene Name: SNRPB2
Alternative Gene Name: Msl1, U2B''
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008333: 88%, ENSRNOG00000004967: 90%
Entrez Gene ID: 6629
Uniprot ID: P08579
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ
• Gene Sequence: AKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQ
• Gene ID - Mouse: ENSMUSG00000008333
• Gene ID - Rat: ENSRNOG00000004967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.