Description
Product Description
Protein Description: small nuclear ribonucleoprotein 35kDa (U11/U12)
Gene Name: SNRNP35
Alternative Gene Name: U1SNRNPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029402: 94%, ENSRNOG00000001060: 94%
Entrez Gene ID: 11066
Uniprot ID: Q16560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNRNP35
Alternative Gene Name: U1SNRNPBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029402: 94%, ENSRNOG00000001060: 94%
Entrez Gene ID: 11066
Uniprot ID: Q16560
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS |
Gene Sequence | LGGGLGGKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERS |
Gene ID - Mouse | ENSMUSG00000029402 |
Gene ID - Rat | ENSRNOG00000001060 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SNRNP35 pAb (ATL-HPA067031) | |
Datasheet | Anti SNRNP35 pAb (ATL-HPA067031) Datasheet (External Link) |
Vendor Page | Anti SNRNP35 pAb (ATL-HPA067031) at Atlas Antibodies |
Documents & Links for Anti SNRNP35 pAb (ATL-HPA067031) | |
Datasheet | Anti SNRNP35 pAb (ATL-HPA067031) Datasheet (External Link) |
Vendor Page | Anti SNRNP35 pAb (ATL-HPA067031) |