Protein Description: synuclein, alpha interacting protein
Gene Name: SNCAIP
Alternative Gene Name: SYPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024534: 68%, ENSRNOG00000018254: 64%
Entrez Gene ID: 9627
Uniprot ID: Q9Y6H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNCAIP
Alternative Gene Name: SYPH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024534: 68%, ENSRNOG00000018254: 64%
Entrez Gene ID: 9627
Uniprot ID: Q9Y6H5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RKASAVIHDQHKLSTEETEISPPLVKCGSAYEPENQSKDFLNKTFSDPHGRKVEKTTPDCQLRAFHLQSSAAESKPEEQVSGLNRTSSQGPEERSEYLK |
Documents & Links for Anti SNCAIP pAb (ATL-HPA064687) | |
Datasheet | Anti SNCAIP pAb (ATL-HPA064687) Datasheet (External Link) |
Vendor Page | Anti SNCAIP pAb (ATL-HPA064687) at Atlas |
Documents & Links for Anti SNCAIP pAb (ATL-HPA064687) | |
Datasheet | Anti SNCAIP pAb (ATL-HPA064687) Datasheet (External Link) |
Vendor Page | Anti SNCAIP pAb (ATL-HPA064687) |