Protein Description: synuclein, alpha (non A4 component of amyloid precursor)
Gene Name: SNCA
Alternative Gene Name: alpha-synuclein, NACP, PARK1, PARK4, PD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025889: 93%, ENSRNOG00000008656: 93%
Entrez Gene ID: 6622
Uniprot ID: P37840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNCA
Alternative Gene Name: alpha-synuclein, NACP, PARK1, PARK4, PD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025889: 93%, ENSRNOG00000008656: 93%
Entrez Gene ID: 6622
Uniprot ID: P37840
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPE |
Documents & Links for Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) | |
Datasheet | Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) at Atlas |
Documents & Links for Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) | |
Datasheet | Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SNCA pAb (ATL-HPA005459 w/enhanced validation) |