Protein Description: small nuclear RNA activating complex, polypeptide 3, 50kDa
Gene Name: SNAPC3
Alternative Gene Name: MGC132011, MGC33124, PTFbeta, SNAP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028483: 74%, ENSRNOG00000010825: 75%
Entrez Gene ID: 6619
Uniprot ID: Q92966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNAPC3
Alternative Gene Name: MGC132011, MGC33124, PTFbeta, SNAP50
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028483: 74%, ENSRNOG00000010825: 75%
Entrez Gene ID: 6619
Uniprot ID: Q92966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT |
| Documents & Links for Anti SNAPC3 pAb (ATL-HPA066031) | |
| Datasheet | Anti SNAPC3 pAb (ATL-HPA066031) Datasheet (External Link) |
| Vendor Page | Anti SNAPC3 pAb (ATL-HPA066031) at Atlas |
| Documents & Links for Anti SNAPC3 pAb (ATL-HPA066031) | |
| Datasheet | Anti SNAPC3 pAb (ATL-HPA066031) Datasheet (External Link) |
| Vendor Page | Anti SNAPC3 pAb (ATL-HPA066031) |