Anti SNAPC2 pAb (ATL-HPA077597)

Catalog No:
ATL-HPA077597-25
$447.00
Protein Description: small nuclear RNA activating complex polypeptide 2
Gene Name: SNAPC2
Alternative Gene Name: PTFdelta, SNAP45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011837: 61%, ENSRNOG00000001056: 66%
Entrez Gene ID: 6618
Uniprot ID: Q13487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL
Gene ID - Mouse ENSMUSG00000011837
Gene ID - Rat ENSMUSG00000011837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti SNAPC2 pAb (ATL-HPA077597)
Datasheet Anti SNAPC2 pAb (ATL-HPA077597) Datasheet (External Link)
Vendor Page Anti SNAPC2 pAb (ATL-HPA077597) at Atlas

Documents & Links for Anti SNAPC2 pAb (ATL-HPA077597)
Datasheet Anti SNAPC2 pAb (ATL-HPA077597) Datasheet (External Link)
Vendor Page Anti SNAPC2 pAb (ATL-HPA077597)