Protein Description: small nuclear RNA activating complex polypeptide 2
Gene Name: SNAPC2
Alternative Gene Name: PTFdelta, SNAP45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011837: 61%, ENSRNOG00000001056: 66%
Entrez Gene ID: 6618
Uniprot ID: Q13487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNAPC2
Alternative Gene Name: PTFdelta, SNAP45
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000011837: 61%, ENSRNOG00000001056: 66%
Entrez Gene ID: 6618
Uniprot ID: Q13487
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | APSSAPRTPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVL |
| Documents & Links for Anti SNAPC2 pAb (ATL-HPA077597) | |
| Datasheet | Anti SNAPC2 pAb (ATL-HPA077597) Datasheet (External Link) |
| Vendor Page | Anti SNAPC2 pAb (ATL-HPA077597) at Atlas |
| Documents & Links for Anti SNAPC2 pAb (ATL-HPA077597) | |
| Datasheet | Anti SNAPC2 pAb (ATL-HPA077597) Datasheet (External Link) |
| Vendor Page | Anti SNAPC2 pAb (ATL-HPA077597) |