Protein Description: small nuclear RNA activating complex polypeptide 1
Gene Name: SNAPC1
Alternative Gene Name: PTFgamma, SNAP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021113: 86%, ENSRNOG00000009296: 87%
Entrez Gene ID: 6617
Uniprot ID: Q16533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNAPC1
Alternative Gene Name: PTFgamma, SNAP43
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021113: 86%, ENSRNOG00000009296: 87%
Entrez Gene ID: 6617
Uniprot ID: Q16533
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | FRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKP |
| Documents & Links for Anti SNAPC1 pAb (ATL-HPA067076) | |
| Datasheet | Anti SNAPC1 pAb (ATL-HPA067076) Datasheet (External Link) |
| Vendor Page | Anti SNAPC1 pAb (ATL-HPA067076) at Atlas |
| Documents & Links for Anti SNAPC1 pAb (ATL-HPA067076) | |
| Datasheet | Anti SNAPC1 pAb (ATL-HPA067076) Datasheet (External Link) |
| Vendor Page | Anti SNAPC1 pAb (ATL-HPA067076) |