Anti SNAP29 pAb (ATL-HPA056492)

Atlas Antibodies

Catalog No: ATL-HPA056492-25

• 
• 

Product Description

Protein Description: synaptosomal-associated protein, 29kDa
Gene Name: SNAP29
Alternative Gene Name: CEDNIK, SNAP-29
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022765: 86%, ENSRNOG00000001867: 84%
Entrez Gene ID: 9342
Uniprot ID: O95721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKE
• Gene Sequence: VASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKE
• Gene ID - Mouse: ENSMUSG00000022765
• Gene ID - Rat: ENSRNOG00000001867
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.