Protein Description: snail family zinc finger 3
Gene Name: SNAI3
Alternative Gene Name: SMUC, Zfp293, ZNF293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006587: 64%, ENSRNOG00000013586: 64%
Entrez Gene ID: 333929
Uniprot ID: Q3KNW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNAI3
Alternative Gene Name: SMUC, Zfp293, ZNF293
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006587: 64%, ENSRNOG00000013586: 64%
Entrez Gene ID: 333929
Uniprot ID: Q3KNW1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | THSSHRVPNYRRLETQREINGACSACGGLVVPLLPRDKEAPSVPGDVPQPWDRSSAVACISLPLLPRIEEAL |
Documents & Links for Anti SNAI3 pAb (ATL-HPA071127) | |
Datasheet | Anti SNAI3 pAb (ATL-HPA071127) Datasheet (External Link) |
Vendor Page | Anti SNAI3 pAb (ATL-HPA071127) at Atlas |
Documents & Links for Anti SNAI3 pAb (ATL-HPA071127) | |
Datasheet | Anti SNAI3 pAb (ATL-HPA071127) Datasheet (External Link) |
Vendor Page | Anti SNAI3 pAb (ATL-HPA071127) |