Description
Product Description
Protein Description: snail family transcriptional repressor 1
Gene Name: SNAI1
Alternative Gene Name: SLUGH2, SNA, SNAH, SNAIL, SNAIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042821: 82%, ENSRNOG00000009594: 84%
Entrez Gene ID: 6615
Uniprot ID: O95863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SNAI1
Alternative Gene Name: SLUGH2, SNA, SNAH, SNAIL, SNAIL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042821: 82%, ENSRNOG00000009594: 84%
Entrez Gene ID: 6615
Uniprot ID: O95863
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG |
| Gene Sequence | SVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLG |
| Gene ID - Mouse | ENSMUSG00000042821 |
| Gene ID - Rat | ENSRNOG00000009594 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti SNAI1 pAb (ATL-HPA056831) | |
| Datasheet | Anti SNAI1 pAb (ATL-HPA056831) Datasheet (External Link) |
| Vendor Page | Anti SNAI1 pAb (ATL-HPA056831) at Atlas Antibodies |
| Documents & Links for Anti SNAI1 pAb (ATL-HPA056831) | |
| Datasheet | Anti SNAI1 pAb (ATL-HPA056831) Datasheet (External Link) |
| Vendor Page | Anti SNAI1 pAb (ATL-HPA056831) |