Description
Product Description
Protein Description: SMAD specific E3 ubiquitin protein ligase 2
Gene Name: SMURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018363: 96%, ENSRNOG00000014623: 98%
Entrez Gene ID: 64750
Uniprot ID: Q9HAU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018363: 96%, ENSRNOG00000014623: 98%
Entrez Gene ID: 64750
Uniprot ID: Q9HAU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD |
Gene Sequence | LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD |
Gene ID - Mouse | ENSMUSG00000018363 |
Gene ID - Rat | ENSRNOG00000014623 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SMURF2 pAb (ATL-HPA071508) | |
Datasheet | Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link) |
Vendor Page | Anti SMURF2 pAb (ATL-HPA071508) at Atlas Antibodies |
Documents & Links for Anti SMURF2 pAb (ATL-HPA071508) | |
Datasheet | Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link) |
Vendor Page | Anti SMURF2 pAb (ATL-HPA071508) |