Anti SMURF2 pAb (ATL-HPA071508)

Catalog No:
ATL-HPA071508-25
$395.00

Description

Product Description

Protein Description: SMAD specific E3 ubiquitin protein ligase 2
Gene Name: SMURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018363: 96%, ENSRNOG00000014623: 98%
Entrez Gene ID: 64750
Uniprot ID: Q9HAU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
Gene Sequence LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
Gene ID - Mouse ENSMUSG00000018363
Gene ID - Rat ENSRNOG00000014623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SMURF2 pAb (ATL-HPA071508)
Datasheet Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link)
Vendor Page Anti SMURF2 pAb (ATL-HPA071508) at Atlas Antibodies

Documents & Links for Anti SMURF2 pAb (ATL-HPA071508)
Datasheet Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link)
Vendor Page Anti SMURF2 pAb (ATL-HPA071508)

Product Description

Protein Description: SMAD specific E3 ubiquitin protein ligase 2
Gene Name: SMURF2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018363: 96%, ENSRNOG00000014623: 98%
Entrez Gene ID: 64750
Uniprot ID: Q9HAU4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
Gene Sequence LSCFVDENTPISGTNGATCGQSSDPRLAERRVRSQRHRNYMSRTHLHTPPD
Gene ID - Mouse ENSMUSG00000018363
Gene ID - Rat ENSRNOG00000014623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SMURF2 pAb (ATL-HPA071508)
Datasheet Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link)
Vendor Page Anti SMURF2 pAb (ATL-HPA071508) at Atlas Antibodies

Documents & Links for Anti SMURF2 pAb (ATL-HPA071508)
Datasheet Anti SMURF2 pAb (ATL-HPA071508) Datasheet (External Link)
Vendor Page Anti SMURF2 pAb (ATL-HPA071508)