Anti SMUG1 pAb (ATL-HPA065892)

Atlas Antibodies

Catalog No: ATL-HPA065892-25

• 

Product Description

Protein Description: single-strand-selective monofunctional uracil-DNA glycosylase 1
Gene Name: SMUG1
Alternative Gene Name: FDG, HMUDG, UNG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036061: 88%, ENSRNOG00000036842: 84%
Entrez Gene ID: 23583
Uniprot ID: Q53HV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQT
• Gene Sequence: FLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQT
• Gene ID - Mouse: ENSMUSG00000036061
• Gene ID - Rat: ENSRNOG00000036842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.