Description
Product Description
Protein Description: single-strand-selective monofunctional uracil-DNA glycosylase 1
Gene Name: SMUG1
Alternative Gene Name: FDG, HMUDG, UNG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036061: 88%, ENSRNOG00000036842: 84%
Entrez Gene ID: 23583
Uniprot ID: Q53HV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMUG1
Alternative Gene Name: FDG, HMUDG, UNG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036061: 88%, ENSRNOG00000036842: 84%
Entrez Gene ID: 23583
Uniprot ID: Q53HV7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQT |
Gene Sequence | FLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQT |
Gene ID - Mouse | ENSMUSG00000036061 |
Gene ID - Rat | ENSRNOG00000036842 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SMUG1 pAb (ATL-HPA065892) | |
Datasheet | Anti SMUG1 pAb (ATL-HPA065892) Datasheet (External Link) |
Vendor Page | Anti SMUG1 pAb (ATL-HPA065892) at Atlas Antibodies |
Documents & Links for Anti SMUG1 pAb (ATL-HPA065892) | |
Datasheet | Anti SMUG1 pAb (ATL-HPA065892) Datasheet (External Link) |
Vendor Page | Anti SMUG1 pAb (ATL-HPA065892) |