Protein Description: small muscle protein, X-linked
Gene Name: SMPX
Alternative Gene Name: DFN6, DFNX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041476: 85%, ENSRNOG00000007495: 79%
Entrez Gene ID: 23676
Uniprot ID: Q9UHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMPX
Alternative Gene Name: DFN6, DFNX4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041476: 85%, ENSRNOG00000007495: 79%
Entrez Gene ID: 23676
Uniprot ID: Q9UHP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK |
Documents & Links for Anti SMPX pAb (ATL-HPA077360) | |
Datasheet | Anti SMPX pAb (ATL-HPA077360) Datasheet (External Link) |
Vendor Page | Anti SMPX pAb (ATL-HPA077360) at Atlas |
Documents & Links for Anti SMPX pAb (ATL-HPA077360) | |
Datasheet | Anti SMPX pAb (ATL-HPA077360) Datasheet (External Link) |
Vendor Page | Anti SMPX pAb (ATL-HPA077360) |