Anti SMNDC1 pAb (ATL-HPA070666)

Catalog No:
ATL-HPA070666-25
$447.00

Description

Product Description

Protein Description: survival motor neuron domain containing 1
Gene Name: SMNDC1
Alternative Gene Name: SMNR, SPF30, TDRD16C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025024: 100%, ENSRNOG00000014833: 100%
Entrez Gene ID: 10285
Uniprot ID: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Gene Sequence KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Gene ID - Mouse ENSMUSG00000025024
Gene ID - Rat ENSRNOG00000014833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SMNDC1 pAb (ATL-HPA070666)
Datasheet Anti SMNDC1 pAb (ATL-HPA070666) Datasheet (External Link)
Vendor Page Anti SMNDC1 pAb (ATL-HPA070666) at Atlas Antibodies

Documents & Links for Anti SMNDC1 pAb (ATL-HPA070666)
Datasheet Anti SMNDC1 pAb (ATL-HPA070666) Datasheet (External Link)
Vendor Page Anti SMNDC1 pAb (ATL-HPA070666)

Product Description

Protein Description: survival motor neuron domain containing 1
Gene Name: SMNDC1
Alternative Gene Name: SMNR, SPF30, TDRD16C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025024: 100%, ENSRNOG00000014833: 100%
Entrez Gene ID: 10285
Uniprot ID: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Gene Sequence KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Gene ID - Mouse ENSMUSG00000025024
Gene ID - Rat ENSRNOG00000014833
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SMNDC1 pAb (ATL-HPA070666)
Datasheet Anti SMNDC1 pAb (ATL-HPA070666) Datasheet (External Link)
Vendor Page Anti SMNDC1 pAb (ATL-HPA070666) at Atlas Antibodies

Documents & Links for Anti SMNDC1 pAb (ATL-HPA070666)
Datasheet Anti SMNDC1 pAb (ATL-HPA070666) Datasheet (External Link)
Vendor Page Anti SMNDC1 pAb (ATL-HPA070666)