Description
Product Description
Protein Description: survival motor neuron domain containing 1
Gene Name: SMNDC1
Alternative Gene Name: SMNR, SPF30, TDRD16C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025024: 100%, ENSRNOG00000014833: 98%
Entrez Gene ID: 10285
Uniprot ID: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMNDC1
Alternative Gene Name: SMNR, SPF30, TDRD16C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025024: 100%, ENSRNOG00000014833: 98%
Entrez Gene ID: 10285
Uniprot ID: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA |
Gene Sequence | VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA |
Gene ID - Mouse | ENSMUSG00000025024 |
Gene ID - Rat | ENSRNOG00000014833 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SMNDC1 pAb (ATL-HPA061214) | |
Datasheet | Anti SMNDC1 pAb (ATL-HPA061214) Datasheet (External Link) |
Vendor Page | Anti SMNDC1 pAb (ATL-HPA061214) at Atlas Antibodies |
Documents & Links for Anti SMNDC1 pAb (ATL-HPA061214) | |
Datasheet | Anti SMNDC1 pAb (ATL-HPA061214) Datasheet (External Link) |
Vendor Page | Anti SMNDC1 pAb (ATL-HPA061214) |