Anti SMNDC1 pAb (ATL-HPA061214)

Atlas Antibodies

Catalog No: ATL-HPA061214-25

• 

Product Description

Protein Description: survival motor neuron domain containing 1
Gene Name: SMNDC1
Alternative Gene Name: SMNR, SPF30, TDRD16C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025024: 100%, ENSRNOG00000014833: 98%
Entrez Gene ID: 10285
Uniprot ID: O75940
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA
• Gene Sequence: VEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMA
• Gene ID - Mouse: ENSMUSG00000025024
• Gene ID - Rat: ENSRNOG00000014833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.