Anti SMN1 pAb (ATL-HPA073601)

Atlas Antibodies

Catalog No: ATL-HPA073601-25

• 
• 

Product Description

Protein Description: survival of motor neuron 1, telomeric
Gene Name: SMN1
Alternative Gene Name: BCD541, GEMIN1, SMA, SMA@, SMA1, SMA2, SMA3, SMNT, TDRD16A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021645: 74%, ENSRNOG00000018067: 72%
Entrez Gene ID: 6606
Uniprot ID: Q16637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
• Gene Sequence: IDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPP
• Gene ID - Mouse: ENSMUSG00000021645
• Gene ID - Rat: ENSRNOG00000018067
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.