Anti SMLR1 pAb (ATL-HPA066060)

Atlas Antibodies

Catalog No: ATL-HPA066060-25

• 

Product Description

Protein Description: small leucine-rich protein 1
Gene Name: SMLR1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096546: 56%, ENSRNOG00000047821: 47%
Entrez Gene ID: 100507203
Uniprot ID: H3BR10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW
• Gene Sequence: FRIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKW
• Gene ID - Mouse: ENSMUSG00000096546
• Gene ID - Rat: ENSRNOG00000047821
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.