Protein Description: small integral membrane protein 17
Gene Name: SMIM17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093536: 66%, ENSRNOG00000042502: 64%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMIM17
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093536: 66%, ENSRNOG00000042502: 64%
Entrez Gene ID: 147670
Uniprot ID: P0DL12
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MQSLRPEQTRGLLEPERTKTLLPRESRAWEKPPHPACTKDWEAVEVGASS |
| Documents & Links for Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) | |
| Datasheet | Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) at Atlas |
| Documents & Links for Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) | |
| Datasheet | Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM17 pAb (ATL-HPA071861 w/enhanced validation) |