Protein Description: small integral membrane protein 13
Gene Name: SMIM13
Alternative Gene Name: C6orf228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091264: 79%, ENSRNOG00000043288: 77%
Entrez Gene ID: 221710
Uniprot ID: P0DJ93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMIM13
Alternative Gene Name: C6orf228
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091264: 79%, ENSRNOG00000043288: 77%
Entrez Gene ID: 221710
Uniprot ID: P0DJ93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | WHLFLSKFKFLRELVGDTGSQEGDHEPSGSETEEDTSSSPHRIRSARQRRAPADEGHRPLT |
| Documents & Links for Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) | |
| Datasheet | Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) at Atlas |
| Documents & Links for Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) | |
| Datasheet | Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM13 pAb (ATL-HPA065706 w/enhanced validation) |