Protein Description: small integral membrane protein 1 (Vel blood group)
Gene Name: SMIM1
Alternative Gene Name: Vel
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078350: 70%, ENSRNOG00000043193: 67%
Entrez Gene ID: 388588
Uniprot ID: B2RUZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMIM1
Alternative Gene Name: Vel
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078350: 70%, ENSRNOG00000043193: 67%
Entrez Gene ID: 388588
Uniprot ID: B2RUZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL |
| Documents & Links for Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) | |
| Datasheet | Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) at Atlas |
| Documents & Links for Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) | |
| Datasheet | Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation) |