Anti SMIM1 pAb (ATL-HPA069088 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA069088-25

• 

Product Description

Protein Description: small integral membrane protein 1 (Vel blood group)
Gene Name: SMIM1
Alternative Gene Name: Vel
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078350: 70%, ENSRNOG00000043193: 67%
Entrez Gene ID: 388588
Uniprot ID: B2RUZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL
• Gene Sequence: QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL
• Gene ID - Mouse: ENSMUSG00000078350
• Gene ID - Rat: ENSRNOG00000043193
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.