Description
Product Description
Protein Description: SMG1 phosphatidylinositol 3-kinase-related kinase
Gene Name: SMG1
Alternative Gene Name: ATX, KIAA0421, LIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030655: 98%, ENSRNOG00000012274: 25%
Entrez Gene ID: 23049
Uniprot ID: Q96Q15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMG1
Alternative Gene Name: ATX, KIAA0421, LIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030655: 98%, ENSRNOG00000012274: 25%
Entrez Gene ID: 23049
Uniprot ID: Q96Q15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS |
Gene Sequence | QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS |
Gene ID - Mouse | ENSMUSG00000030655 |
Gene ID - Rat | ENSRNOG00000012274 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SMG1 pAb (ATL-HPA073972) | |
Datasheet | Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link) |
Vendor Page | Anti SMG1 pAb (ATL-HPA073972) at Atlas Antibodies |
Documents & Links for Anti SMG1 pAb (ATL-HPA073972) | |
Datasheet | Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link) |
Vendor Page | Anti SMG1 pAb (ATL-HPA073972) |