Protein Description: SMG1 phosphatidylinositol 3-kinase-related kinase
Gene Name: SMG1
Alternative Gene Name: ATX, KIAA0421, LIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030655: 98%, ENSRNOG00000012274: 25%
Entrez Gene ID: 23049
Uniprot ID: Q96Q15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMG1
Alternative Gene Name: ATX, KIAA0421, LIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030655: 98%, ENSRNOG00000012274: 25%
Entrez Gene ID: 23049
Uniprot ID: Q96Q15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QLFSRLNHPEVYVRQSICNLLCRVAQDSPHLILYPAIVGTISLSSESQASGNKFSTAIPTLLGNIQGEELLVSECEGGSPPASQDSNKDEPKS |
| Documents & Links for Anti SMG1 pAb (ATL-HPA073972) | |
| Datasheet | Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link) |
| Vendor Page | Anti SMG1 pAb (ATL-HPA073972) at Atlas |
| Documents & Links for Anti SMG1 pAb (ATL-HPA073972) | |
| Datasheet | Anti SMG1 pAb (ATL-HPA073972) Datasheet (External Link) |
| Vendor Page | Anti SMG1 pAb (ATL-HPA073972) |