![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100762/180732/atl-hpa071309_anti-smc2-pab-atl-hpa071309_62400__67744.1681136892.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG")
Protein Description: structural maintenance of chromosomes 2
Gene Name: SMC2
Alternative Gene Name: CAP-E, hCAP-E, SMC2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 87%, ENSRNOG00000022325: 91%
Entrez Gene ID: 10592
Uniprot ID: O95347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMC2
Alternative Gene Name: CAP-E, hCAP-E, SMC2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 87%, ENSRNOG00000022325: 91%
Entrez Gene ID: 10592
Uniprot ID: O95347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD |
| Documents & Links for Anti SMC2 pAb (ATL-HPA071309) | |
| Datasheet | Anti SMC2 pAb (ATL-HPA071309) Datasheet (External Link) |
| Vendor Page | Anti SMC2 pAb (ATL-HPA071309) at Atlas |
| Documents & Links for Anti SMC2 pAb (ATL-HPA071309) | |
| Datasheet | Anti SMC2 pAb (ATL-HPA071309) Datasheet (External Link) |
| Vendor Page | Anti SMC2 pAb (ATL-HPA071309) |