Anti SMC2 pAb (ATL-HPA071309)

Atlas Antibodies

Catalog No: ATL-HPA071309-100

• 
• 
• 

Product Description

Protein Description: structural maintenance of chromosomes 2
Gene Name: SMC2
Alternative Gene Name: CAP-E, hCAP-E, SMC2L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028312: 87%, ENSRNOG00000022325: 91%
Entrez Gene ID: 10592
Uniprot ID: O95347
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD
• Gene Sequence: LSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTALELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGPD
• Gene ID - Mouse: ENSMUSG00000028312
• Gene ID - Rat: ENSRNOG00000022325
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.