Protein Description: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Gene Name: SMARCA1
Alternative Gene Name: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031099: 90%, ENSRNOG00000003762: 88%
Entrez Gene ID: 6594
Uniprot ID: P28370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SMARCA1
Alternative Gene Name: hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031099: 90%, ENSRNOG00000003762: 88%
Entrez Gene ID: 6594
Uniprot ID: P28370
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ |
| Documents & Links for Anti SMARCA1 pAb (ATL-HPA064712) | |
| Datasheet | Anti SMARCA1 pAb (ATL-HPA064712) Datasheet (External Link) |
| Vendor Page | Anti SMARCA1 pAb (ATL-HPA064712) at Atlas |
| Documents & Links for Anti SMARCA1 pAb (ATL-HPA064712) | |
| Datasheet | Anti SMARCA1 pAb (ATL-HPA064712) Datasheet (External Link) |
| Vendor Page | Anti SMARCA1 pAb (ATL-HPA064712) |