Anti SMAD5 pAb (ATL-HPA058931)

Atlas Antibodies

Catalog No: ATL-HPA058931-100

• 
• 
• 

Product Description

Protein Description: SMAD family member 5
Gene Name: SMAD5
Alternative Gene Name: Dwfc, JV5-1, MADH5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021540: 89%, ENSRNOG00000022870: 100%
Entrez Gene ID: 4090
Uniprot ID: Q99717
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
• Gene Sequence: PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE
• Gene ID - Mouse: ENSMUSG00000021540
• Gene ID - Rat: ENSRNOG00000022870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti SMAD5 pAb (ATL-HPA058931) – 1 Found

Zhu, Ziwen; Achreja, Abhinav; Meurs, Noah; Animasahun, Olamide; Owen, Sarah; Mittal, Anjali; Parikh, Pooja; Lo, Ting-Wen; Franco-Barraza, Janusz; Shi, Jiaqi; Gunchick, Valerie; Sherman, Mara H; Cukierman, Edna; Pickering, Andrew M; Maitra, Anirban; Sahai, Vaibhav; Morgan, Meredith A; Nagrath, Sunitha; Lawrence, Theodore S; Nagrath, Deepak. Tumour-reprogrammed stromal BCAT1 fuels branched-chain ketoacid dependency in stromal-rich PDAC tumours. Nature Metabolism. 2020;2(8):775-792.