Protein Description: SLX4 structure-specific endonuclease subunit
Gene Name: SLX4
Alternative Gene Name: BTBD12, FANCP, KIAA1784, KIAA1987
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039738: 65%, ENSRNOG00000024445: 69%
Entrez Gene ID: 84464
Uniprot ID: Q8IY92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLX4
Alternative Gene Name: BTBD12, FANCP, KIAA1784, KIAA1987
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039738: 65%, ENSRNOG00000024445: 69%
Entrez Gene ID: 84464
Uniprot ID: Q8IY92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA |
| Documents & Links for Anti SLX4 pAb (ATL-HPA066238) | |
| Datasheet | Anti SLX4 pAb (ATL-HPA066238) Datasheet (External Link) |
| Vendor Page | Anti SLX4 pAb (ATL-HPA066238) at Atlas |
| Documents & Links for Anti SLX4 pAb (ATL-HPA066238) | |
| Datasheet | Anti SLX4 pAb (ATL-HPA066238) Datasheet (External Link) |
| Vendor Page | Anti SLX4 pAb (ATL-HPA066238) |