Description
Product Description
Protein Description: SLU7 homolog, splicing factor
Gene Name: SLU7
Alternative Gene Name: 9G8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020409: 91%, ENSRNOG00000003822: 95%
Entrez Gene ID: 10569
Uniprot ID: O95391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLU7
Alternative Gene Name: 9G8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020409: 91%, ENSRNOG00000003822: 95%
Entrez Gene ID: 10569
Uniprot ID: O95391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQ |
Gene Sequence | YSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQ |
Gene ID - Mouse | ENSMUSG00000020409 |
Gene ID - Rat | ENSRNOG00000003822 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti SLU7 pAb (ATL-HPA058120) | |
Datasheet | Anti SLU7 pAb (ATL-HPA058120) Datasheet (External Link) |
Vendor Page | Anti SLU7 pAb (ATL-HPA058120) at Atlas Antibodies |
Documents & Links for Anti SLU7 pAb (ATL-HPA058120) | |
Datasheet | Anti SLU7 pAb (ATL-HPA058120) Datasheet (External Link) |
Vendor Page | Anti SLU7 pAb (ATL-HPA058120) |