Protein Description: SLIT and NTRK like family member 1
Gene Name: SLITRK1
Alternative Gene Name: KIAA1910, LRRC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075478: 99%, ENSRNOG00000009209: 99%
Entrez Gene ID: 114798
Uniprot ID: Q96PX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLITRK1
Alternative Gene Name: KIAA1910, LRRC12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075478: 99%, ENSRNOG00000009209: 99%
Entrez Gene ID: 114798
Uniprot ID: Q96PX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLAETGTHSNSYLDTSRVSIS |
| Documents & Links for Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) | |
| Datasheet | Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) | |
| Datasheet | Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLITRK1 pAb (ATL-HPA074835 w/enhanced validation) |