Anti SLCO5A1 pAb (ATL-HPA025062)

Atlas Antibodies

Catalog No: ATL-HPA025062-25

• 

Product Description

Protein Description: solute carrier organic anion transporter family, member 5A1
Gene Name: SLCO5A1
Alternative Gene Name: OATP-J, OATP5A1, OATPRP4, SLC21A15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025938: 79%, ENSRNOG00000008966: 83%
Entrez Gene ID: 81796
Uniprot ID: Q9H2Y9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
• Gene Sequence: SVDAVSDDDVLKEKSNNSEQADKKVSSMGFGKDVRDLPRAAVRILSNM
• Gene ID - Mouse: ENSMUSG00000025938
• Gene ID - Rat: ENSRNOG00000008966
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti SLCO5A1 pAb (ATL-HPA025062) – 2 Found

Olszewski-Hamilton, U; Svoboda, M; Thalhammer, T; Buxhofer-Ausch, V; Geissler, K; Hamilton, G. Organic Anion Transporting Polypeptide 5A1 (OATP5A1) in Small Cell Lung Cancer (SCLC) Cells: Possible Involvement in Chemoresistance to Satraplatin. Biomarkers In Cancer. 3( 24179389):31-40. 

Patik, Izabel; Kovacsics, Daniella; Német, Orsolya; Gera, Melinda; Várady, György; Stieger, Bruno; Hagenbuch, Bruno; Szakács, Gergely; Özvegy-Laczka, Csilla. Functional expression of the 11 human Organic Anion Transporting Polypeptides in insect cells reveals that sodium fluorescein is a general OATP substrate. Biochemical Pharmacology. 2015;98(4):649-58.