Anti SLCO4C1 pAb (ATL-HPA058249)

Catalog No:
ATL-HPA058249-25
$447.00

Description

Product Description

Protein Description: solute carrier organic anion transporter family member 4C1
Gene Name: SLCO4C1
Alternative Gene Name: OATP-H, OATP4C1, OATPX, SLC21A20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040693: 71%, ENSRNOG00000022711: 71%
Entrez Gene ID: 353189
Uniprot ID: Q6ZQN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK
Gene Sequence PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK
Gene ID - Mouse ENSMUSG00000040693
Gene ID - Rat ENSRNOG00000022711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249)
Datasheet Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link)
Vendor Page Anti SLCO4C1 pAb (ATL-HPA058249) at Atlas Antibodies

Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249)
Datasheet Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link)
Vendor Page Anti SLCO4C1 pAb (ATL-HPA058249)

Product Description

Protein Description: solute carrier organic anion transporter family member 4C1
Gene Name: SLCO4C1
Alternative Gene Name: OATP-H, OATP4C1, OATPX, SLC21A20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040693: 71%, ENSRNOG00000022711: 71%
Entrez Gene ID: 353189
Uniprot ID: Q6ZQN7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK
Gene Sequence PKHLPGTAEIQAGKTSQAHQSNSNADVKFGKSIKDFPAALKNLMK
Gene ID - Mouse ENSMUSG00000040693
Gene ID - Rat ENSRNOG00000022711
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249)
Datasheet Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link)
Vendor Page Anti SLCO4C1 pAb (ATL-HPA058249) at Atlas Antibodies

Documents & Links for Anti SLCO4C1 pAb (ATL-HPA058249)
Datasheet Anti SLCO4C1 pAb (ATL-HPA058249) Datasheet (External Link)
Vendor Page Anti SLCO4C1 pAb (ATL-HPA058249)