Anti SLCO3A1 pAb (ATL-HPA066327)

Atlas Antibodies

Catalog No: ATL-HPA066327-25

• 

Product Description

Protein Description: solute carrier organic anion transporter family member 3A1
Gene Name: SLCO3A1
Alternative Gene Name: OATP-D, OATP3A1, SLC21A11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025790: 94%, ENSRNOG00000032798: 94%
Entrez Gene ID: 28232
Uniprot ID: Q9UIG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
• Gene Sequence: LPEFLTHQYKYEAGEIRWGAEGRDVCAANGSGGDEGPDPDLICRNRTATNM
• Gene ID - Mouse: ENSMUSG00000025790
• Gene ID - Rat: ENSRNOG00000032798
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.