Protein Description: solute carrier family 9 member C2 (putative)
Gene Name: SLC9C2
Alternative Gene Name: MGC43026, SLC9A11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033210: 33%, ENSRNOG00000022007: 31%
Entrez Gene ID: 284525
Uniprot ID: Q5TAH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC9C2
Alternative Gene Name: MGC43026, SLC9A11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033210: 33%, ENSRNOG00000022007: 31%
Entrez Gene ID: 284525
Uniprot ID: Q5TAH2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LSLMYSITKGYIKSQEDAKLLIKQIAVCESIYQKLCEILETNKQDAVKELVLMEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHEV |
| Documents & Links for Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) | |
| Datasheet | Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) at Atlas |
| Documents & Links for Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) | |
| Datasheet | Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SLC9C2 pAb (ATL-HPA079529 w/enhanced validation) |