Anti SLC9A9 pAb (ATL-HPA058234)

Atlas Antibodies

Catalog No: ATL-HPA058234-25

• 

Product Description

Protein Description: solute carrier family 9, subfamily A (NHE9, cation proton antiporter 9), member 9
Gene Name: SLC9A9
Alternative Gene Name: FLJ35613, NHE9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031129: 85%, ENSRNOG00000008554: 87%
Entrez Gene ID: 285195
Uniprot ID: Q8IVB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL
• Gene Sequence: TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL
• Gene ID - Mouse: ENSMUSG00000031129
• Gene ID - Rat: ENSRNOG00000008554
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.