Protein Description: solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Gene Name: SLC9A7
Alternative Gene Name: NHE7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037341: 90%, ENSRNOG00000004150: 91%
Entrez Gene ID: 84679
Uniprot ID: Q96T83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC9A7
Alternative Gene Name: NHE7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037341: 90%, ENSRNOG00000004150: 91%
Entrez Gene ID: 84679
Uniprot ID: Q96T83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SWLNIRVGVEEPSEEDQNEHHWQYFRVGVDPDQDPPPNNDSFQVLQGDGPDSARGNRTKQESAWIFRLWY |
Documents & Links for Anti SLC9A7 pAb (ATL-HPA075385) | |
Datasheet | Anti SLC9A7 pAb (ATL-HPA075385) Datasheet (External Link) |
Vendor Page | Anti SLC9A7 pAb (ATL-HPA075385) at Atlas |
Documents & Links for Anti SLC9A7 pAb (ATL-HPA075385) | |
Datasheet | Anti SLC9A7 pAb (ATL-HPA075385) Datasheet (External Link) |
Vendor Page | Anti SLC9A7 pAb (ATL-HPA075385) |