Protein Description: solute carrier family 8 (sodium/calcium exchanger), member 1
Gene Name: SLC8A1
Alternative Gene Name: NCX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054640: 93%, ENSRNOG00000008479: 90%
Entrez Gene ID: 6546
Uniprot ID: P32418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: SLC8A1
Alternative Gene Name: NCX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054640: 93%, ENSRNOG00000008479: 90%
Entrez Gene ID: 6546
Uniprot ID: P32418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE |
| Documents & Links for Anti SLC8A1 pAb (ATL-HPA070007) | |
| Datasheet | Anti SLC8A1 pAb (ATL-HPA070007) Datasheet (External Link) |
| Vendor Page | Anti SLC8A1 pAb (ATL-HPA070007) at Atlas |
| Documents & Links for Anti SLC8A1 pAb (ATL-HPA070007) | |
| Datasheet | Anti SLC8A1 pAb (ATL-HPA070007) Datasheet (External Link) |
| Vendor Page | Anti SLC8A1 pAb (ATL-HPA070007) |