Anti SLC8A1 pAb (ATL-HPA070007)

Atlas Antibodies

Catalog No: ATL-HPA070007-25

• 

Product Description

Protein Description: solute carrier family 8 (sodium/calcium exchanger), member 1
Gene Name: SLC8A1
Alternative Gene Name: NCX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054640: 93%, ENSRNOG00000008479: 90%
Entrez Gene ID: 6546
Uniprot ID: P32418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
• Gene Sequence: RHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
• Gene ID - Mouse: ENSMUSG00000054640
• Gene ID - Rat: ENSRNOG00000008479
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.